SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273068.TTE1211 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273068.TTE1211
Domain Number 1 Region: 4-173
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.09e-33
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 273068.TTE1211
Sequence length 180
Comment (Thermoanaerobacter tengcongensis)
Sequence
MRSLEIRLGGSGGQGLILAGIILAEAAILDGKVSVQSQSYGPEARGGSSKAEVIISDGTI
VYPKVLKPDVLLALTSSAYKSYKEDVKETGLIIVDDSVEVEQESKVKTLKFPILKTAQEV
VGKAYVANIVSLGVIAELTKIVSKESLEKAVLKRVPAGTEELNRKALEEGFKLGGVPWDK
Download sequence
Identical sequences Q8RAK2
273068.TTE1211 gi|20807666|ref|NP_622837.1| WP_011025541.1.99938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]