SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273075.Ta0259m from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273075.Ta0259m
Domain Number 1 Region: 200-460
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.57e-61
Family PFOR Pyr module 0.056
Further Details:      
 
Domain Number 2 Region: 8-224
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-26
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.015
Further Details:      
 
Domain Number 3 Region: 467-581
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.14e-23
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 273075.Ta0259m
Sequence length 585
Comment (Thermoplasma acidophilum)
Sequence
MRQNEVIIRVAGAAGDGVQSAGEILVRTFARSGLYATSYNYYQDIIRGGESWYQVRASDV
KVKNQGDGLDILIALNQDGVERHTNPDINEGGASPLGKDGIAIFDNSIKNYTKRDTNYCP
MPLADIAAKYSKNTLLKNTVGLGAAIAATGIDFNIFADVIRDQFGKKGEIAELNVKAAKE
GYDYYLANFKPLGKKFKFGKKKYMISGGMAVALGAVAGGLKMYVAYPMTPASSALHFLAQ
HAKKYGVFVKIPEDEISAINTVIGANYAGVRAMTGSSGGGFALMTEAVGLSGMTEVPLVI
YEAQRPGPSTGLPTKTEQGDLNQVLGASQGDFPRIVFAPGDIEEAFYLTREAMNIAEKYQ
TPVFVMSDLYLAEHYDTIDSFDLNFNIDHGLRAKDNEQDYKRYLITETGISPRAIPGQPG
NMHNEDSDEHNEYGDVVSDAVTNPQDRIKMMQKRMRKLDTYIEEMKPTPTYRIQDAEYVI
IQWGSTKGAVEEAIDILRAKGIKIGAIEVKNVFPLNPDIGTLLKNRKKILAVENNYSGQL
SKYIAAQFLVKPELITKYDGEAFYPNALAEEIEVRIGKKKEVIRE
Download sequence
Identical sequences WP_010900688.1.49201 273075.Ta0259m gi|16082504|ref|NP_393739.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]