SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273075.Ta0756 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273075.Ta0756
Domain Number 1 Region: 116-378
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.49e-69
Family D-glucarate dehydratase-like 0.0000516
Further Details:      
 
Domain Number 2 Region: 18-131
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.9e-28
Family Enolase N-terminal domain-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 273075.Ta0756
Sequence length 402
Comment (Thermoplasma acidophilum)
Sequence
MFLNSSKSLTDGDYGDRMKITGVNSYIVRNPWKKWVFIELETDDGSVGYGEATVFNGQFS
VSSRLKDVSKFIIGKDPMNVRRLISEWFVSTFNRAHDMVNVALMSGVEAACWDIIGKHHG
SPVYEILGGPVNERIRVYANGWYTAINEVEDWARAAKNVKNRGYTALKFDPFGAGSGFLS
NDEFKRSMEIIRIVHDEVGDDVEMLIEGHGRFNRSMALRIGKELEKYENIGWFEEPVIPE
DIEGLAILSRSLRVPIAAGERFITRYDFVEPFTKGAIHIAQPDVINTGGIIETLSIGAMA
EAHNIAMAPHQAEGPINTFITLNVDAVLGNLKIQEMFDEFAYPQWAWDIVSARPEVSNGY
VKLPRKPGIGIDLRDKVKEYLATEKDPDFNLFAAGWEKRGFS
Download sequence
Identical sequences Q9HK50
273075.Ta0756 gi|16081827|ref|NP_394220.1| WP_010901171.1.49201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]