SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273075.Ta1083 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273075.Ta1083
Domain Number 1 Region: 12-193
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.91e-22
Family Clp protease, ClpP subunit 0.051
Further Details:      
 
Domain Number 2 Region: 362-425
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000119
Family NfeD domain-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 273075.Ta1083
Sequence length 434
Comment (Thermoplasma acidophilum)
Sequence
MHRPFIIAVMAVFLLLLLVSIAADSQAQPQKNVVVIYLDEEIDAGSAAMITSTMNSISNT
TTAAVVIDMNTPGGELENMIQMVSSITSAESRGIITITYVPQNAMAASAGSYVAMATDYI
FMANGTYIGPSTPIVVGGTSLEQQHTTSAMEQYMVSLAAEHGRNTTAAYSMVSNNTAYND
TEAYRIHLINGIYGSLDKALASLSLSSYPQVSVYPSAYDNFLSFLSNAYVDGIFILLGFV
AIMLDIYHGSVVLTIAGITLLILGFLGLQLISASLVGVLLLLMGSVLIILEAKMGHGFAL
LSGVVVGLIGTFLLASPYYSSNPGYSPSPFTTFDLLTSILIVIVAGFLAFYIRRIVRTFK
FRGKWTGAESLIGKMGYAVEGIDEKGWVSVDGIEWQARSSNGSRIPKGSRVKIVGRDGLI
LIVEKQEDEQLRIK
Download sequence
Identical sequences Q9HJ87
WP_010901493.1.49201 gi|16082107|ref|NP_394542.1| 273075.Ta1083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]