SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273075.Ta1423 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273075.Ta1423
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily Pre-PUA domain 2.81e-24
Family Hypothetical protein Ta1423, N-terminal domain 0.0000573
Further Details:      
 
Domain Number 2 Region: 70-150
Classification Level Classification E-value
Superfamily PUA domain-like 4.33e-23
Family PUA domain 0.0000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 273075.Ta1423
Sequence length 153
Comment (Thermoplasma acidophilum)
Sequence
MTSKHFISKKEAKRIWEAMARYGIDITGESLEVAAQKSASAYYIGGKPMVFQAGDLIPSV
YLLNYRNPSRNIVTVDEGAEPHILNGSDLFAPGIVSMDDSIRKGDMIFVKSSKGYFIAVG
MAEMDAGEVMATKRGKAARIIHFPGDELIRAFP
Download sequence
Identical sequences Q9HIB8
APC5505 NYSGXRC-6383b gi|16082395|ref|NP_394877.1| WP_010901826.1.49201 273075.Ta1423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]