SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273116.TVN0492 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273116.TVN0492
Domain Number 1 Region: 14-194
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.07e-26
Family Clp protease, ClpP subunit 0.02
Further Details:      
 
Domain Number 2 Region: 363-428
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000654
Family NfeD domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 273116.TVN0492
Sequence length 439
Comment (Thermoplasma volcanium)
Sequence
MDSAKALLLIIVIFILSLLLVEGIGNSVATPQKNIVVINLDEEIDAGSANMITSTLSSVS
NSTTAAVVIYMNTPGGILENMMQMVSAISSVENQGIITITYVPVDGMAASAGSYVAMACD
YIFMGNGSYIGPSTPIVVAGTSLEQQHTTSAMEQYMVSLAEQHGRNTTAVFSMVSNNTAY
TDVEAYKIGISNGIYNSLSEALASIHLQNYPLVEVYPSAYDNFLSFIGNAYVDGIFILLG
FVAIMLDIYHGSVVLTVIGIALLVLGFLGLQLISASLVGVLLLILGSVLILLEAKMGHGF
ALLSGVVIGLVGTFMLASPYYSSNPGYSPSPFTTFDLLTSILIVIVAGFLAFYIRRIVRT
IKFRGRWTGAESLIGRSAKAVSNINSHGWVSVDGIEWQAKSNDGKPINKGEPVKIVDRSG
LVLIVERTNTEEKQDLKLK
Download sequence
Identical sequences Q97BG4
gi|13541323|ref|NP_111011.1| 273116.TVN0492 WP_010916750.1.10044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]