SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273121.WS0846 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  273121.WS0846
Domain Number - Region: 85-129
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000837
Family NfeD domain-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 273121.WS0846
Sequence length 131
Comment (Wolinella succinogenes)
Sequence
MWVFIVGVILLGLELLVGGFYLLWYGLGLALSGGIGWMLGSQAWMAQAIIGLLIGLGLMI
LFQKRFSQGAKVIKDEFLLQEGEGIVQEGGMVEFRGTLWRYDSPKGESFEAGERVKVVPG
EGNWVKIAKKD
Download sequence
Identical sequences Q7MS27
273121.WS0846 gi|34557242|ref|NP_907057.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]