SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273123.YPTB1577 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273123.YPTB1577
Domain Number 1 Region: 158-398
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.1e-69
Family D-glucarate dehydratase-like 0.000000159
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.6e-30
Family Enolase N-terminal domain-like 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 273123.YPTB1577
Sequence length 400
Comment (Yersinia pseudotuberculosis IP32953)
Sequence
MNPDPDYSAAYVILDTDNPALSGHGLTFTIGRGNEICCVAIHALEHLIVGRDLASMTANM
GKFWREFTSDSQLRWIGPEKGAIHLATGAVINAVWDLWSKAEGKPLWRLVADMSPEELVR
CIDFRYITDCITPEEALTLLQQRAHNKALRLEKLQDEGYPCYTTSAGWLGYPDDKLRRLC
QDAVDAGFDYLKLKVGRDLEDDIRRVRITREVLGPDRKLMIDANQIWETNEAIPWVNQLA
FANPWFIEEPTNPDDIEGHRRIRQGVAPVKVATGEMCQNRIMFKQFIMREAIDVVQIDAC
RLGGVNEVLAVMLMAAKYDLPVCPHAGGVGLCEYVQHLAMIDYLCIAGTDKGRVIEYVDH
LHEHFVHPCVIKNAAYMPPEQPGFSIEMHQSSIEKYRFRV
Download sequence
Identical sequences Q0WGK8 Q66C33
214092.YPO1567 273123.YPTB1577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]