SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 273123.YPTB2557 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273123.YPTB2557
Domain Number 1 Region: 108-307
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.22e-51
Family D-glucarate dehydratase-like 0.000000147
Further Details:      
 
Domain Number 2 Region: 1-98
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.77e-28
Family Enolase N-terminal domain-like 0.0000379
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 273123.YPTB2557
Sequence length 323
Comment (Yersinia pseudotuberculosis IP32953)
Sequence
MRTATLYRYSVPMEAGVILRHQRLKSRDGLLVKLQQGELSGWGEIAPLPEFSQETLDQAQ
VAAECWLQHWVSGVESDDSVLPSVAFGLSCAQAELKQTLPLSADYRKASLCTGDPDELFA
VLQALPGEKVAKVKVGLYEAVRDGMIVNVLLEALPDLTLRLDANRSWSRAKADGFAKYVN
PALRSRIAFLEEPCKTRAESREFAQDTGIAIAWDESVREADFQVEAEPGVAAIVIKPTLV
GSLARCQQLVQQAHQAGLVAVISSSIESSLGLTQLARLAAWLTPATVPGLDTLDLMQAQV
VRPWPDSPLPLITTEQLGVVWHR
Download sequence
Identical sequences Q669D0
273123.YPTB2557 WP_011192654.1.26383 WP_011192654.1.50185 gi|51596876|ref|YP_071067.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]