SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 279010.BL00962 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  279010.BL00962
Domain Number 1 Region: 21-232
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.73e-30
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Weak hits

Sequence:  279010.BL00962
Domain Number - Region: 228-268
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0314
Family HBL-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 279010.BL00962
Sequence length 276
Comment (Bacillus licheniformis ATCC 14580)
Sequence
MNTHQNRYSVQSKVSALINCRLFQSFITTVIVLNAISIGLETYAFFKPYQKVFFIVDCLF
LTIFVIELSLKLFVQKQHFFKNNWNVFDFVIVAGSLILYNTNFVSVLRIFRVLRVLRTIT
SVPSLRRIVNALFMAIPTISSVIILMSIIFYVYAVIGTMFFSAIAPEYFGNLQLSLLTLF
QTFTLESWASGIFRPIFAESGWSWLYFVSFIVIATFIMINLIVGEIVNNAQKISQEIEDE
TGELKEDTKEIKELRAEVKELKALLQTYITQNEKKD
Download sequence
Identical sequences A0A1Y0YKG8 Q65MK7 T5HKQ8
gi|442564189|ref|YP_006712178.2| gi|52079205|ref|YP_077996.1| GO.9114 WP_003179701.1.10695 WP_003179701.1.12567 WP_003179701.1.1290 WP_003179701.1.20727 WP_003179701.1.21456 WP_003179701.1.22930 WP_003179701.1.27377 WP_003179701.1.27603 WP_003179701.1.27836 WP_003179701.1.30581 WP_003179701.1.31090 WP_003179701.1.34504 WP_003179701.1.34863 WP_003179701.1.34956 WP_003179701.1.35726 WP_003179701.1.35764 WP_003179701.1.42641 WP_003179701.1.46361 WP_003179701.1.46635 WP_003179701.1.47006 WP_003179701.1.48016 WP_003179701.1.50447 WP_003179701.1.54544 WP_003179701.1.55910 WP_003179701.1.57471 WP_003179701.1.62441 WP_003179701.1.62618 WP_003179701.1.64701 WP_003179701.1.70162 WP_003179701.1.719 WP_003179701.1.71919 WP_003179701.1.7403 WP_003179701.1.74244 WP_003179701.1.8120 WP_003179701.1.85389 WP_003179701.1.8660 WP_003179701.1.86740 WP_003179701.1.86759 WP_003179701.1.94809 WP_003179701.1.9500 WP_003179701.1.95031 WP_003179701.1.9558 WP_003179701.1.96953 WP_003179701.1.98374 WP_003179701.1.99505 279010.BL00962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]