SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 279010.BL01412 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  279010.BL01412
Domain Number 1 Region: 32-196
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.27e-24
Family Clp protease, ClpP subunit 0.026
Further Details:      
 
Domain Number 2 Region: 379-438
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000549
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 279010.BL01412
Sequence length 439
Comment (Bacillus licheniformis ATCC 14580)
Sequence
MLLKKFRIFVALACGFVLFLLLGVHLTVKADGDTVYVIPIEETVEKGLSKFLERSFQEAE
DMYAKHIILDINTPGGAVDAVLDMADTIHNSDIPVTAYVNRRALSAGAYLALNADDIYMA
PGGKMGAAAIIDTQGNAADKKSESLWLAEMEDAAKKNGRDPKYALAMADADVDAKEVGAP
KGELLTLSPDKALKVGYSEGTVSSLDDLLKKLNLKDAKIERAEVSFAEKVARFITHPVVI
PILLSIGSLGLIVELYSPGFGIPGFMGLTALLLFFYGHLVAGLAGMETILLFAAGIILII
LEIFLPGGIAGIAGLIAIVASLFLASGSFKVMAVSILIATAVSIAASILLTRVLGKRMKF
FKKLILTDSTSTESGYVSNESRRDLIGKIGVTYTPLRPSGTVIIDDERLDVVSEGSFTAK
DKKVKVVKVEGSRIVVREL
Download sequence
Identical sequences Q65H63
WP_011198129.1.1290 WP_011198129.1.74244 gi|163119554|ref|YP_079877.2| gi|404489968|ref|YP_006714074.1| 279010.BL01412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]