SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 279010.BL02206 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  279010.BL02206
Domain Number 1 Region: 5-101
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.85e-24
Family Anti-sigma factor antagonist SpoIIaa 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 279010.BL02206
Sequence length 108
Comment (Bacillus licheniformis ATCC 14580)
Sequence
MNLAVDTNKNDHVIEVKVAGEIDVHTAPTLRDELMPLAEEGKDLKVSLKDVSYMDSTGLG
VFVGIYKAVNRTGGSLVLENLSERLIRLFDITGLKDIIDISGKSEGGL
Download sequence
Identical sequences A0A1Y0YJQ5 Q65N50 T5HV84
279010.BL02206 WP_003179140.1.10695 WP_003179140.1.12567 WP_003179140.1.1290 WP_003179140.1.20727 WP_003179140.1.21456 WP_003179140.1.22930 WP_003179140.1.27377 WP_003179140.1.27603 WP_003179140.1.27836 WP_003179140.1.30581 WP_003179140.1.31090 WP_003179140.1.31877 WP_003179140.1.34504 WP_003179140.1.34863 WP_003179140.1.34956 WP_003179140.1.35726 WP_003179140.1.35764 WP_003179140.1.42641 WP_003179140.1.46361 WP_003179140.1.46635 WP_003179140.1.47006 WP_003179140.1.48016 WP_003179140.1.50447 WP_003179140.1.54544 WP_003179140.1.55910 WP_003179140.1.57471 WP_003179140.1.62441 WP_003179140.1.62618 WP_003179140.1.64701 WP_003179140.1.70162 WP_003179140.1.719 WP_003179140.1.71919 WP_003179140.1.7403 WP_003179140.1.74244 WP_003179140.1.8120 WP_003179140.1.85389 WP_003179140.1.8660 WP_003179140.1.86740 WP_003179140.1.86759 WP_003179140.1.94809 WP_003179140.1.9500 WP_003179140.1.95031 WP_003179140.1.9558 WP_003179140.1.96953 WP_003179140.1.98374 WP_003179140.1.99505 gi|404487879|ref|YP_006711985.1| gi|163119248|ref|YP_077797.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]