SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 279010.BL05339 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  279010.BL05339
Domain Number - Region: 14-60
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0183
Family DNA-binding N-terminal domain of transcription activators 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 279010.BL05339
Sequence length 76
Comment (Bacillus licheniformis ATCC 14580)
Sequence
MKENEKIKFIQDEVLTAAEAGELLGVTRQRLSALVTSGKLKPVKKVGTVSLFLRDHVETQ
KKELEAGRKKYRPYDE
Download sequence
Identical sequences Q65EU8
279010.BL05339 gi|404490774|ref|YP_006714880.1| WP_011198296.1.1290 WP_011198296.1.22930 WP_011198296.1.27836 WP_011198296.1.34504 WP_011198296.1.34956 WP_011198296.1.36860 WP_011198296.1.70162 WP_011198296.1.7403 WP_011198296.1.74244 WP_011198296.1.82128 WP_011198296.1.9558 WP_011198296.1.97335 WP_011198296.1.99505 gi|52081890|ref|YP_080681.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]