SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 279238.Saro_0401 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  279238.Saro_0401
Domain Number 1 Region: 35-221
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.18e-26
Family Clp protease, ClpP subunit 0.043
Further Details:      
 
Domain Number 2 Region: 394-458
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000157
Family NfeD domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 279238.Saro_0401
Sequence length 460
Comment (Novosphingobium aromaticivorans DSM 12444)
Sequence
MDTIVRHSWLRLFLLSLLLAGFAQAWANAQTQPGRDEVPVLTIEGAIGPATADYVAGGIA
RAAEQGAPMVIIRMDTPGGLDTSMREIIRAILGSPVPVVTYVSPSGARAASAGAFILTAS
HVAAMAPGTNVGAATPVQLGAPAAPSTPKSSDQQADDKGTSSPAKSGGASEAKALNDAIA
YIRSLAEMRGRNADWAEAAVREAASLSAKSALEQKVIDIVARDDGDLLAQINGLTVALGN
GQVRLQTDGVRLTEVLPDWRTRLLSAITNPNIALILMMIGAYGLLFEFMNPGALYPGTIG
AISLLLGFYALSVLPVNYAGLALIVLGLALMGAEAFSPSFGILGIGGMIAFVLGATIMFD
TDVPQFRVALPVLAAIAVASLGATVLTMRLALRSRRSSVATGREEMIGATGSVLDWQGTG
GHVRVHGERWNARAVSELHAGQEVRIIRLQGLTVEVEPAN
Download sequence
Identical sequences Q2GBC4
gi|87198426|ref|YP_495683.1| 279238.Saro_0401 WP_011444063.1.26809 WP_011444063.1.96002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]