SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 279238.Saro_3675 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  279238.Saro_3675
Domain Number 1 Region: 114-157,191-402
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.87e-101
Family SCOPe 0.00000378
Further Details:      
 
Domain Number 2 Region: 1-115
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.39e-59
Family SCOPe 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 279238.Saro_3675
Sequence length 402
Comment (Novosphingobium aromaticivorans DSM 12444)
Sequence
MKITAARVIITCPGRNFVTLKIETDQGVYGIGDATLNGRELSVVAYLQEHVAPCLIGMDP
RRIEDIWQYVYRGAYWRRGPVTMRAIAAVDMALWDIKAKMAGMPLYQLLGGRSRDGIMVY
GHANGSDIAETVEAVGHYIDMGYKAIRAQTGVPGIKDAYGVGRGKLYYEPADASLPSVTG
WDTRKALNYVPKLFEELRKTYGFDHHLLHDGHHRYTPQEAANLGKMLEPYQLFWLEDCTP
AENQEAFRLVRQHTVTPLAVGEIFNTIWDAKDLIQNQLIDYIRATVVGAGGLTHLRRIAD
LASLYQVRTGCHGATDLSPVTMGCALHFDTWVPNFGIQEYMRHTEETDAVFPHDYWFEKG
ELFVGETPGHGVDIDEELAAKYPYKPAYLPVARLEDGTMWNW
Download sequence
Identical sequences A4XF23
2qjj_A 2qjj_B 2qjj_C 2qjj_D 2qjn_A 2qjn_B 2qjn_C 2qjn_D gi|146275900|ref|YP_001166060.1|NC_009427 gi|146275900|ref|YP_001166060.1| 279238.Saro_3675 WP_011906920.1.26809 WP_011906920.1.96002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]