SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 279808.SH0965 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  279808.SH0965
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.63e-24
Family Anti-sigma factor antagonist SpoIIaa 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 279808.SH0965
Sequence length 108
Comment (Staphylococcus haemolyticus)
Sequence
MNLNIETVTHDEYYEVIVAGELDVYTVPELEEVLMPMRQEGTHDIHVNVTNVSYMDSTGL
GLFVGTLKALNQNDKELYILGVSDRIGRLFDITGLKDLMHVNEGTEVE
Download sequence
Identical sequences A0A1F2KRU4 A0A1N5A7T9 A0A1Q8DCN3 A0A2K3V8B1 Q4L7V1
gi|70725966|ref|YP_252880.1| WP_011275274.1.10109 WP_011275274.1.101253 WP_011275274.1.101333 WP_011275274.1.101994 WP_011275274.1.1027 WP_011275274.1.10422 WP_011275274.1.1225 WP_011275274.1.12258 WP_011275274.1.12511 WP_011275274.1.12694 WP_011275274.1.12910 WP_011275274.1.13054 WP_011275274.1.1380 WP_011275274.1.14283 WP_011275274.1.14470 WP_011275274.1.14598 WP_011275274.1.15116 WP_011275274.1.15895 WP_011275274.1.16163 WP_011275274.1.16219 WP_011275274.1.16313 WP_011275274.1.16495 WP_011275274.1.18129 WP_011275274.1.18844 WP_011275274.1.19491 WP_011275274.1.1978 WP_011275274.1.19908 WP_011275274.1.20173 WP_011275274.1.20471 WP_011275274.1.20834 WP_011275274.1.20864 WP_011275274.1.20888 WP_011275274.1.21698 WP_011275274.1.22102 WP_011275274.1.23003 WP_011275274.1.2357 WP_011275274.1.23919 WP_011275274.1.26373 WP_011275274.1.28455 WP_011275274.1.29037 WP_011275274.1.297 WP_011275274.1.30324 WP_011275274.1.31288 WP_011275274.1.31494 WP_011275274.1.35706 WP_011275274.1.3637 WP_011275274.1.36410 WP_011275274.1.36612 WP_011275274.1.37394 WP_011275274.1.39200 WP_011275274.1.40163 WP_011275274.1.402 WP_011275274.1.4220 WP_011275274.1.42727 WP_011275274.1.43577 WP_011275274.1.43780 WP_011275274.1.44205 WP_011275274.1.44226 WP_011275274.1.44543 WP_011275274.1.4581 WP_011275274.1.46811 WP_011275274.1.48297 WP_011275274.1.48683 WP_011275274.1.49011 WP_011275274.1.49079 WP_011275274.1.49577 WP_011275274.1.510 WP_011275274.1.51540 WP_011275274.1.51997 WP_011275274.1.52664 WP_011275274.1.53148 WP_011275274.1.53191 WP_011275274.1.53313 WP_011275274.1.54595 WP_011275274.1.55530 WP_011275274.1.55678 WP_011275274.1.5596 WP_011275274.1.58064 WP_011275274.1.58879 WP_011275274.1.589 WP_011275274.1.58915 WP_011275274.1.59500 WP_011275274.1.60041 WP_011275274.1.61337 WP_011275274.1.61390 WP_011275274.1.63295 WP_011275274.1.63323 WP_011275274.1.63725 WP_011275274.1.64863 WP_011275274.1.65907 WP_011275274.1.65972 WP_011275274.1.66148 WP_011275274.1.66202 WP_011275274.1.67078 WP_011275274.1.67111 WP_011275274.1.67157 WP_011275274.1.67271 WP_011275274.1.67478 WP_011275274.1.68076 WP_011275274.1.68328 WP_011275274.1.68612 WP_011275274.1.69277 WP_011275274.1.69544 WP_011275274.1.7082 WP_011275274.1.70824 WP_011275274.1.71127 WP_011275274.1.7114 WP_011275274.1.73426 WP_011275274.1.74301 WP_011275274.1.74601 WP_011275274.1.74627 WP_011275274.1.74640 WP_011275274.1.75368 WP_011275274.1.76890 WP_011275274.1.76990 WP_011275274.1.77553 WP_011275274.1.78694 WP_011275274.1.79350 WP_011275274.1.81188 WP_011275274.1.8193 WP_011275274.1.81983 WP_011275274.1.82096 WP_011275274.1.82332 WP_011275274.1.82380 WP_011275274.1.82878 WP_011275274.1.83289 WP_011275274.1.83671 WP_011275274.1.83870 WP_011275274.1.84269 WP_011275274.1.84838 WP_011275274.1.85768 WP_011275274.1.87015 WP_011275274.1.8732 WP_011275274.1.87507 WP_011275274.1.88266 WP_011275274.1.88267 WP_011275274.1.8871 WP_011275274.1.89180 WP_011275274.1.8934 WP_011275274.1.90039 WP_011275274.1.90041 WP_011275274.1.90558 WP_011275274.1.91141 WP_011275274.1.92193 WP_011275274.1.92210 WP_011275274.1.92713 WP_011275274.1.92797 WP_011275274.1.9312 WP_011275274.1.93353 WP_011275274.1.93901 WP_011275274.1.94858 WP_011275274.1.96210 WP_011275274.1.98145 WP_011275274.1.98869 WP_011275274.1.98902 279808.SH0965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]