SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281090.Lxx01430 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281090.Lxx01430
Domain Number 1 Region: 74-290
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.56e-51
Family D-glucarate dehydratase-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281090.Lxx01430
Sequence length 330
Comment (Leifsonia xyli xyli CTCB0)
Sequence
MMPGLSDLLATSHVVRLPMTSRFRGIAAREAVLFDGPQGWTEFSPFTEYDDAESAAWLHA
AIDFGWRATPPGLRERIPVNATVPAVAAGEVPRVLSRYPGSRTAKVKVAEPGQTLADDIA
RVRAVRERLGPEGRLRIDANALWNVDEAEHAIHALAPFDLEYVEQPCPSVEELAEIRRRT
AYMGIPIAADESVRRAGDPLAVARAGAADLLVIKAQPLGGIHSALRIVEAAGLPVVVSSA
IDTSVGVAMGAHLAAAVPELEFDCGLGTVAMFERDVAVDPLLPVGGSIPVVRPAIAPDRL
AELAAPAERREWWRNRVRRCYGQLERTLER
Download sequence
Identical sequences A0A1E2SMQ2 Q6AHC8
WP_011185222.1.68452 WP_011185222.1.84704 gi|50954034|ref|YP_061322.1| 281090.Lxx01430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]