SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281090.Lxx12450 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281090.Lxx12450
Domain Number 1 Region: 57-93,179-275
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.02e-38
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0002
Further Details:      
 
Domain Number 2 Region: 3-56
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000265
Family TS-N domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281090.Lxx12450
Sequence length 276
Comment (Leifsonia xyli xyli CTCB0)
Sequence
MANISIADIKALREQLGTGMVDTKKALEEAGGDLEKATEILRLKGAKGNAKRADRSTSEG
LVAAKENANGTATMIELACETDFVAKGEKFVALSDTVLDAIAAAGSTTIEEALAAPAGSQ
TVAEFIGDEAAILGEKIELRRVAVVNGEHVAIYLHKTSKDLPPQVGVVVGYAGDDTETAR
SIAQHISFANPAHLTREDVPAEEVESERRIVKEISRSEGKPEAALPKIIEGRLGAFFKQV
ALLEQEYARDNKLTISQVLKDSGLTVSGFARFKVGA
Download sequence
Identical sequences A0A1E2SHZ5 Q6AEV6
gi|50954906|ref|YP_062194.1| 281090.Lxx12450 WP_011186084.1.68452 WP_011186084.1.84704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]