SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281090.Lxx17200 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281090.Lxx17200
Domain Number 1 Region: 138-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.25e-126
Family Enolase 0.0000000533
Further Details:      
 
Domain Number 2 Region: 4-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.11e-53
Family Enolase N-terminal domain-like 0.0000052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281090.Lxx17200
Sequence length 426
Comment (Leifsonia xyli xyli CTCB0)
Sequence
MAAIEAVGAREILDSRGNPTVEVEVLLEDGTVSRAAVPSGASTGAFEAYELRDGDKGRYL
GKGVEKAVDAVLDEIGPAIEGFEASDQRIVDEAMIELDGTDNKKRLGANAMLGVSLAVAK
AAADSADLPLFRYLGGPNAHVLPVPMMNIINGGAHADTGVDIQEFMILPIGAETFSEGLR
WGVETYHSLKALLKSKGLNTGLGDEGGFAPELEHNRAALDLIAEAIEKAGFTVGSQIALG
LDVASTEFFENGVYRFEGQDRTAAEMSAYYTDLANNYPLVSIEDPLAEDDWEGWAHLNAE
IGSTLQLVGDDLFVTNPKRLAQGIQQKAANSILVKVNQIGTLTETLDAVSLAQRSGMTAV
LSHRSGETEDTTIADLAVATDSGQIKTGAPARSERVAKYNQLLRIEEELGEAAVYAGRSA
FPRYQG
Download sequence
Identical sequences A0A1E2SLX9 Q6ADR6
WP_011186468.1.68452 WP_011186468.1.84704 gi|50955297|ref|YP_062585.1| 281090.Lxx17200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]