SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281309.BT9727_1889 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281309.BT9727_1889
Domain Number 1 Region: 79-139
Classification Level Classification E-value
Superfamily NfeD domain-like 1.11e-16
Family NfeD domain-like 0.0028
Further Details:      
 
Weak hits

Sequence:  281309.BT9727_1889
Domain Number - Region: 10-65
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0301
Family Clc chloride channel 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281309.BT9727_1889
Sequence length 142
Comment (Bacillus thuringiensis konkukian)
Sequence
MAAWVIWFIIAGILFIAEMLSITFYMLWLGIGAVVGGLIALFAPEALLLQVVAGAIVSLT
LTFFTKRISKNFREAKGFTDTVDMLVGKKGIVMQAITNETNGIVKVDGDTWTAVADAPID
TGEKVVVIKRNSTILQVKKESE
Download sequence
Identical sequences A0A0U0GLW1 A0A1Q4L2I4 A0A1S9A1S8 A0A242W4J7 A0A243D0L2 A0A2B6CJ40 B7JKR2 C3G225 Q6HJQ6
281309.BT9727_1889 405535.BCAH820_2105 WP_000741984.1.100409 WP_000741984.1.15163 WP_000741984.1.33536 WP_000741984.1.34158 WP_000741984.1.41365 WP_000741984.1.43104 WP_000741984.1.45385 WP_000741984.1.4865 WP_000741984.1.55968 WP_000741984.1.56580 WP_000741984.1.60841 WP_000741984.1.63611 WP_000741984.1.66331 WP_000741984.1.67239 WP_000741984.1.7545 WP_000741984.1.85901 WP_000741984.1.90155 WP_000741984.1.94373 YP_036220.1.62562 gi|49480585|ref|YP_036220.1| gi|218903221|ref|YP_002451055.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]