SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281310.NTHI1719 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281310.NTHI1719
Domain Number 1 Region: 199-354
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000288
Family DNA gyrase/MutL, N-terminal domain 0.094
Further Details:      
 
Weak hits

Sequence:  281310.NTHI1719
Domain Number - Region: 75-118
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0216
Family Anti-sigma factor antagonist SpoIIaa 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281310.NTHI1719
Sequence length 359
Comment (Haemophilus influenzae 86 028NP)
Sequence
MDIRLWRSIVRQRTLRALTSKEKKIRQRGGKPKYKHLAHKSFNLFEVIAPYKIILAKEIG
YEFVAFKEELEEKAKLAARSRSRLKLNFRDTDIIDAAACSVLIAVLDTIKSQYRTLKFQI
VRPKSKPADHRKHIPYDVDAIFCHIGLYKSLGFNYTSSSSQENVKCWHYVYSDSADGEIT
KPLLDELKSMGVKGIYPSYIEAIANAVEHAYAQNIYSEREFPIKRWWMLLAILEGKLSLF
VCDLGHGIPNTLEKTQKANVLSAIWNRLKQLGKPTKDCLYIKASTLIKETRTGLGHRGKG
GSDIRAFIDKTPGSRLIIRSNRGMYVYNGKDKPDLTKESRYSINGTVVQWNIPLQEIKE
Download sequence
Identical sequences Q4QKE0
281310.NTHI1719 WP_011272604.1.10621 WP_011272604.1.12329 WP_011272604.1.15261 WP_011272604.1.23065 WP_011272604.1.23149 WP_011272604.1.23920 WP_011272604.1.25656 WP_011272604.1.27712 WP_011272604.1.28397 WP_011272604.1.32618 WP_011272604.1.37003 WP_011272604.1.38938 WP_011272604.1.39279 WP_011272604.1.40343 WP_011272604.1.40942 WP_011272604.1.42240 WP_011272604.1.43923 WP_011272604.1.44893 WP_011272604.1.4569 WP_011272604.1.50588 WP_011272604.1.50795 WP_011272604.1.54653 WP_011272604.1.61426 WP_011272604.1.63539 WP_011272604.1.74240 WP_011272604.1.74810 WP_011272604.1.76348 WP_011272604.1.79255 WP_011272604.1.79785 WP_011272604.1.8829 WP_011272604.1.90320 WP_011272604.1.91188 WP_011272604.1.91769 WP_011272604.1.92858 WP_011272604.1.97721 WP_011272604.1.99326 WP_011272604.1.99776 gi|68250055|ref|YP_249167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]