SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA00127 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA00127
Domain Number 1 Region: 168-198
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000795
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Weak hits

Sequence:  281687.CJA00127
Domain Number - Region: 240-288
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0216
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA00127
Sequence length 296
Comment (Caenorhabditis japonica)
Sequence
MDHVNAAAPPLEESSVRAAFLTYLSDFARDKAEELLELSPKFSCKQLVDEMMKTFEDPNR
AKMERQQLRQCLQHADESVDDFSTRVRKLAQSAHAGKSRDFVQEKAKESFIDGLLFNLKF
HVKGESPSSFQEAQNSAMKFEMLLAEAARANTILPQGLAVMPAPAPPHQPKKAKGECFYC
GIPGYFANECRRRVKDRANGIFRRENKTGFNPRSQTGFNPRSQTRSFPQNNPITNHQIFA
NQSTVQTIQSAVPALHAQMDALKAELEVRQNQINALIRRNDELAGSAPVTQSSNAR
Download sequence
Identical sequences CJA00127 281687.CJA00127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]