SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA00331 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA00331
Domain Number 1 Region: 389-606
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.21e-57
Family Tandem AAA-ATPase domain 0.00000794
Further Details:      
 
Domain Number 2 Region: 542-669,697-779
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.22e-39
Family Tandem AAA-ATPase domain 0.00073
Further Details:      
 
Domain Number 3 Region: 189-243
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000113
Family Retrovirus zinc finger-like domains 0.0014
Further Details:      
 
Domain Number 4 Region: 287-333
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000116
Family Retrovirus zinc finger-like domains 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA00331
Sequence length 825
Comment (Caenorhabditis japonica)
Sequence
MSETGGWGRSENAPKESTGGGFGGSRGGGFGGGGNSNSGSFGSKPSGFGGGGGGSGFGGG
NSGGGSGFGSGNGGSGFGSGNGGSGFGSGNGGSGFGSGNGGSGFGSGNGGSGFGSGNKES
AFGGGNSGSGFGGGNSGSGFGGGNKGSGFGGGNGGSGFGAGGNSGSGFGAGGFLVLEAAA
ALVSAETMDLPDSERNNNCFNCNQPGHRSNECDQPRKPREGASGNCFNCQQPGHLSRDCP
EERKPREYRGGNGGGFGGGNDFGSSENTRFDGSGGGFGSRSGGFGGGNDEQAPMKCFNCR
EEGHRSSDCPQPPRGCFNCGDAGHRASECTNPRQPREGAEGETPKATYVPEESSMEDIFS
MQRIAEGLMFDKFFDAEVVLTSCGKQSRVPACKRFEDAKLTEKMLSNVTHAGYTRTTPIQ
QYSLPIIRDGGDIMACAQTGSGKTAAFLLPIMSKLIDDNDLNTAGEAGCYPRCIILTPTR
ELADQIYNEGRKFSFQTMVEIKPVYGGLAVNYNRGQLEKGASIIVGTVGRIKHFIEEGII
CLNKIRYFVLDEADRMIDAMGFGADITTIASYPGMPDKKNRQTLMFSATFSDAVQEAARE
FLRPEYMMIAIDKIGAANKCVVQEFQLCEKYEKKDKLLELLGIDIDDYAISKGAQIKSIM
KCWMFFQTRMFIPKRLSSSCHDVQWLIRWQQFSPAHKFLVLLLFIHGAREQRERSEALRQ
FRNGSKPVLIATAVAERGLDIKGVDHVINYDMPDNIDDYIHRIGRTGRVGNSGRATSFLG
LDCPLIPDLLKVLADAEQIVPEWMVDNHGASAFGANVPTQEEDKW
Download sequence
Identical sequences CJA00331 281687.CJA00331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]