SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA00368 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA00368
Domain Number 1 Region: 316-469
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.91e-35
Family Retroviral integrase, catalytic domain 0.016
Further Details:      
 
Domain Number 2 Region: 195-250
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000488
Family Retroviral protease (retropepsin) 0.016
Further Details:      
 
Weak hits

Sequence:  281687.CJA00368
Domain Number - Region: 136-172
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00243
Family Retrovirus zinc finger-like domains 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA00368
Sequence length 892
Comment (Caenorhabditis japonica)
Sequence
MKIFGAQRSIMVQRQACFHISRSLGNWEDPLEYTNHIGQLVADAKLATMTADEWSVFLFF
RGLDAPGDAAAKMYLMQFTEMAERKGETITLSQIHDEWMRFVQIKQQTKIVATSKQNPQT
PVEVWKLEASKTKRRENPKFTPKWGSKDRRPPFCDYCKRAGHHISKCFLKRKDEGTETQS
IKVDVVNAELSAKRSVRVNVNGKPLQFDLDTGSMITIINSESWNMIGRPPLERVEHHISC
ANGSEMRVLGRASDFRAKSQSPLMRKAMEVMVNQIEIPSAGMARLKDNPTVRRGNCQQNT
KRTRITPSKPCPDTKKPWAHIYVDFAGPINGFWFLVVEDAKTKYAEVKLTRKASAAATVD
LIEDIFATHGYPDWIVSDNGTQLSSHLFKKMCESHGITHKTTATYCPRSNGAAERFVDIL
KRGVSKIKRSASINQRVLNNFLINYRNTPHAALNGATPAECHFSRKIRTTRSSPMLAERA
SENTEWTHYQNKMKGVYDKRNGARANTFKVGQKVYARVQHGNKLSWGYGKVRRRVGSVLY
EVRVGEKMQRCHANQLRQRHGDKSPEELFSDSNFPLFFDSMPVQKTNSPKLIKNPRVSEG
LRGETNLLRFPDFSSFSCNYPELDMVNSGRSPRVVRQGVFGSSPAAHDTSRSDGFGRVNR
GNQKMECRSELNEHQSPNSRTFLERKEEVSSPCKQQLESEVQQDVSCVQPAPNLSQSLRR
SQRNRRAPVRYDPCMELQSHSEDRAPKRGSAPYSDRAAARSRGLHIASNCRLAPSQGRTK
DNFRKEEVSSPCKQQLESEVQQDVSCVQPAPNLSQSLRRSQRNRRAPVRYDPCMELQSHS
EDRAPKRGSAPYSDRAAARSRGLHIASNCRGKVLGRHMAALVGINVVTYTWK
Download sequence
Identical sequences CJA00368 281687.CJA00368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]