SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA00392 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA00392
Domain Number 1 Region: 5-179
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.09e-45
Family Ubiquitin carboxyl-terminal hydrolase UCH-L 0.0000878
Further Details:      
 
Domain Number 2 Region: 184-218
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000224
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA00392
Sequence length 256
Comment (Caenorhabditis japonica)
Sequence
MAKGGWQALESNPETINPFLKKIGVSGVECVDVYSFDEEMLQFIPTPQLALILCFPSAEA
REFLGKQYKEVEKAGKKAEGVFFMNQNEGIGNACGTFALFHSLGNLENRVNLGSGKFFKW
FEKAKLVKEDERSDLLSEDTDLAEAHEETAEEGETEQSDHVEYHFITYVNKNGQLFEIGS
LIVVKCAQVGHRKPDCVQRLTKCLKCQKTGHLSKYCKSIGSKKAQSMVVVESAAAEDVEV
NAVRQYVMVEVNDQLI
Download sequence
Identical sequences 281687.CJA00392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]