SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA00525 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA00525
Domain Number 1 Region: 653-752
Classification Level Classification E-value
Superfamily Acid proteases 0.000000675
Family Retroviral protease (retropepsin) 0.042
Further Details:      
 
Domain Number 2 Region: 602-631
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000994
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA00525
Sequence length 764
Comment (Caenorhabditis japonica)
Sequence
TRIEAIAEMEKLGRDLEEMEVDRQDGVQWSGNEEELLGSPKADPLDDFVGVPVERGRMKN
VKNEAKNESVTMKKPSAVALEETAPQHLWSKMMEDEVSVKERKKLMKGFHRFVEKSGLME
EEMLRQLEMHTRCNERVKGVILKPLRKFGDELRGRWYEMGGETWVKSIMNVMRALEVDSA
TELERAVVDAQKEGDSAREAEQECEKLKEEIGILQGQWEAEKKTLIEEAVAAKRENENLR
KRVDVAEKVAKAEKKRAMELKQNLEHAAGESESSDDEIQEIKERIKARSTKHYGQTRTSK
TSSDSCKMPEEDDEMPGENTWEKRSAAWAEKVEKWPEGKWRRRRGKEAQREISTERDSLP
ESWKPEKPSNDTVQDTIVSMTKMMRSSALPEPKTFDGTGNFGEFKRTFLMKFREVIENDE
DLVAILEEKYLKGAARELFRSLKNRYRRPVKLLFAEFEKRLRRRQGDSQAHALAEFDGLQ
KGVNQRMWEYLPEIEKWSQRAYPNIDGETLSQMRVTKLMKAVKEDYNLQNLLIMKRRETP
IAEQYDTLKDIVLQQENERRRDVDRRRGMNGGSKGRREIRWKIKEEPKRHESEQREQRVP
RENPQRNEHWNGLKCFRCGGAGHVAKQCTSKPLCNVEQEEESVGTEMLETCEMLGQKRKV
TIDSGAVVSVISSGAWERLKKGCSDWRDKCEMLEKPQFKLVNASKLSMPVIKQVRLEIWI
RGRKASVVFQIVQNDMDLFLLGTNAFKTVGVELKWQAERAVART
Download sequence
Identical sequences 281687.CJA00525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]