SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA00576 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA00576
Domain Number 1 Region: 208-252
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000247
Family Retrovirus zinc finger-like domains 0.0022
Further Details:      
 
Domain Number 2 Region: 277-317
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000422
Family Retroviral protease (retropepsin) 0.01
Further Details:      
 
Domain Number 3 Region: 518-553
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000704
Family Retroviral protease (retropepsin) 0.0097
Further Details:      
 
Weak hits

Sequence:  281687.CJA00576
Domain Number - Region: 473-499
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000301
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA00576
Sequence length 612
Comment (Caenorhabditis japonica)
Sequence
MFQFDLETEKTFSKWYARHEAAFTVEGKDLEDKSKVSLLMSKMSDEVYEQYSKRICPRKH
TEVEFDETVKTLEQMFDIKKSLFSHRFACINIARDDETPVEYTTKVNSMCESAMLQDIDA
EGWKVFFWLKGLDASRDKSARTYFIRYVEQKWEKKESVNVNDLCEEWKKLLRQNSVVQEM
EQVDKAVRALHTRKDFNRNHKKLWNREQSNGKVDECWNCGKVGHRKPDCVQRLTKCLKCQ
KTGHLSKYCKSKGSKKAQSMVVIESAAAEDLEVNAVRQYVMVEVNDQLIEFQLDTGSDIT
LISRKDWMKFDLETGKTFSKWYARHEAAFTVEGKDLEDKSKVSLLMSKMSDEVYEQYFKR
ICPRKHTEVEFDETVKTLEQMFDIKKSLFSHRFACINIARDDETPVEYTTKVNSMCESAM
LQDIDAEGWKVFFWLKGLDASRDKSARTYFIRYVEQKWEKKESVNVNDLCEEWKKVCLKC
QKTGHLSKYCKSKGSKKAQSMVVIESAAAEDLEVNAVRQYVMVEVNDQLIEFQLDTGSDI
TLISRKDWMKVGEPELEKCPMKFHETAAHSCDTITGTNSTSHLPTSYFSFHFNSTTREPL
VTDGAGCAEEPV
Download sequence
Identical sequences 281687.CJA00576 CJA00576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]