SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA01095 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA01095
Domain Number 1 Region: 9-155
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.14e-34
Family Galectin (animal S-lectin) 0.0004
Further Details:      
 
Domain Number 2 Region: 156-281
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.02e-34
Family Galectin (animal S-lectin) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA01095
Sequence length 283
Comment (Caenorhabditis japonica)
Sequence
MTSHENDTPLPVPYTSRLGQPLDAGQTLNVHGKINDGAQVVELNLLQGGGEIEPQNQVIL
HLKLNFKDKKLVMNSYENGVWGKEERESQPFHVGQDFDLRIRVLDESLEISADNKKVHEF
KHRLPFQSIEYLSVRGDASLNGIHWGGRFYKLPWETGFPAGHLEKGQRVHLYGVPKGDRW
SLDLVARNQDVLFHFNPRLKEKAVVRNSHRNGFWDKEEREGDFPFKKDIGFDLTIVNEEY
SIQIFINRERFATFQHRTPNPIGDYIGLRIDGEVEVTGIEFSH
Download sequence
Identical sequences A0A2H2HVM5
281687.CJA01095 CJA01095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]