SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA01175 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA01175
Domain Number 1 Region: 623-724
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000901
Family Retroviral protease (retropepsin) 0.025
Further Details:      
 
Domain Number 2 Region: 461-490
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000101
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA01175
Sequence length 844
Comment (Caenorhabditis japonica)
Sequence
WSTPLNCRVTPSPTRASITTLRNAVCKDLHAAHERITDVFEQIQVRVEKLEKEGATSVFV
DAVDQREVTTLAGLRSAKHQVSSNSAKFHPSINNKEPQGNSASPQGEQPANQRVSDKSLA
AAAFPGETSDIRKASAVARSKATDTEQSDPVTERDAQQPSVCVITQTDAKEAATSERTRG
TSRSTSQTRRITRAMSASQQPRINVFAMKSAATVPIFSGTNKENFHAFVRNFKDHVRLTN
EPDDKEVRNHLLTVLTDFARDTAEEVLDRNPDATSEDIIDALRAQYEDQYSTQNRLDAIK
ACFQYAQEPVQDYYQRIRKLMREAQTGANRAEVTQVTKEAFRNGLQSEIRFYVTTARSTE
FDQVYRDAIFYEKALQEKERKDRADAAAIASRPRTAEVFAHAAVRNQEQYFDYDNERNYY
PAVAAFNQPPGSPGAMNNSPFNHGYNRNRNINANRDFGRSFEQAQNRNAECWYCGRPGHY
RQDCRKRAADIARGIYRNNMRTPHNMAPHPSRSRNAESRRPPLNPVENHRQPTVRVIQTS
EPHDQSTSTVLQDAQARINQQERMIKMQENQLNDIRWRLEAYQMGRSPGNSPPPSVNLAT
PTDPTPTVATVRQVSTLPITAQIPIRANGIPCYALIDTGSSITVTSENSKDTFCSTPLEP
PQSSTALGLGGNQVNMVGTSVMKFQVGPFTVDHLTHFTEGKCTPTGPTGYTFIIGNDVLR
QLPNFILDYAKGHFLIAGAILPMGNQQERDAYPGNRKSHLKGQNPFPRQDDTSTPTHFSS
KMTPTVTLKRSKNRRSPKSIDIAPSAPRSQPPLTRQATKSTKTNHDELLHSLRKIRKKPV
RSQN
Download sequence
Identical sequences 281687.CJA01175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]