SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA01250 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA01250
Domain Number 1 Region: 321-427
Classification Level Classification E-value
Superfamily Acid proteases 0.000000231
Family Pepsin-like 0.051
Further Details:      
 
Domain Number 2 Region: 232-280
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000523
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA01250
Sequence length 444
Comment (Caenorhabditis japonica)
Sequence
MPGEKEDEASSNFFTQFLLAQAIPEPPVFSASPGKLSISTFEKTFRMKFGTLPHEFQLTL
LETKYLEGKALKVFKGVPAGEKRTVAEALKAMASRLRVSVEDESRTAKAKWEVLRRREGQ
SMEDFCLQIDELSRVAFSRTPPEELSSLKTAKLISALNDHTIRCMIEAQLMDLDEVKHYD
VCRKLATRFEFDAEIRSEKRVSTQSKIMSRTTQFERSATQQGSSNFKPVQRENGGPKRCW
ECQEIGCHAPTCSRAPRSTSVTCYKCGEIGHYSNKCSQEQSSSSAQAVNRPSSGSIQEVN
RPGAKTPIVENLSEGLGPKTVEKGRIGGVEVEMVIDSGATISLIPKTLWHKIVKVNGKEW
ERKCALAEPDITSVFTASNQPMKLVHQVKLETSLKARTRDVVFYVVDVERESVILGTNAF
EAMGISMSIQGXXXXFFFWKFHVF
Download sequence
Identical sequences 281687.CJA01250 CJA01250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]