SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA01646 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA01646
Domain Number 1 Region: 99-136
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000262
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA01646
Sequence length 658
Comment (Caenorhabditis japonica)
Sequence
MASYKQNLPPSALLRQQAAPTDKKSKAEVQRDRQLEEDRKAGTAPAMVDVQTGRDINPHI
PMFISQNPWYVPSEGPTLKHQRPHEERQKKMATVHEWYQKGTTGKSATKFRKGACENCGA
MGHQKRDCFDRPRKANAKETNSNIAEDDHIQPKLSLGFDAKRDRWNGYDPSTHKQVIEDY
EHLEEARKVVREQQIKDGEVEGEAEPETNPEGEVKDEDMYAEDADMAGVSVDMDSRTRIT
VRNLRIREDTAKYLYNLAENSPYYDPKSRSMRENPFAGVAGKELEAARFSGDNFVRYSGE
VTAANEAQVFAWQATRQGVYAHSIAEPTKLEALKKEYEEQKTTIKNETQKELLDKYGGAE
HLERPIDELLLAQTESYIEYNRKGKVIKGKERAAISSRFKEDLYPQNHTSIFGSFWRDGK
WGYHCCHQFVKNSYCTGKEGVDAEKSAAMGTTTSNEQVFKVPKLVEKVEVKEEEEEKEAE
NVKKEEEEKSSSSSSSSSSSSSSSSGSDSDEDGGDDDEEKEKQLEKERLEEKSRREREQR
RREKNREKRGRKKAKLGKRKRRNRDSDSDQKGSSDSSDSDSNSDSDEEMRKAKKKAKKEK
IEGIKAAKECDRNRKYNTDYSNIAPTEKEMEAYQLTNIHSADPMAAYMNSKFEKKHMK
Download sequence
Identical sequences A0A2H2HWJ6
281687.CJA01646 CJA01646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]