SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA02082 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA02082
Domain Number 1 Region: 465-647
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.89e-47
Family Reverse transcriptase 0.0013
Further Details:      
 
Domain Number 2 Region: 324-416
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000563
Family Retroviral protease (retropepsin) 0.0094
Further Details:      
 
Domain Number 3 Region: 645-721
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000425
Family Retroviral integrase, catalytic domain 0.016
Further Details:      
 
Domain Number 4 Region: 253-299
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000384
Family Retrovirus zinc finger-like domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA02082
Sequence length 879
Comment (Caenorhabditis japonica)
Sequence
MPRDITTGDQELAMADLTKQISTLVAALSKLTQVGTASEQHSTDTTKLADAISSRIPMFV
YEPEDGRTFDTWYSRYKDTITKDGFSLQDDVRTRLVISKLDTKQYSHYANRILPKVPSEL
SYEDTIAKLKETFKETSSIYQRRQNFLRTEYHGSSIEEYTGTVLRRFASSDFKSMTDDQL
CCMVWINGLRDPAHIDIRTRALQTMESRPDVTLLQLESEIKRLLDLRADSKCVAGSTPSH
AAEINAIFRKQQRDNNREHGPPSACYRCGGPHWARDCNVKDVKCSKCGKTNHMAKFCRFQ
DKTKPHQKKKVKSVIISLASSSGASRIYRKVFINSKPLRMQLDTGADITLINTKDWAKIG
KPKLDKPSIKVKSATGQPINVKGSFTCDFTINGNSATGTAHVADTDTLLGIDWISKDTQL
WNLLQDNHQINAAFSVIGSACNYLDNTREKLKFDLKSEYPIIFQPGLGKCTKTKASIRLK
PGAQPVFRKARPVPYATLPTITEELDRFVQEGIATPIDHAQWAAPVVPIRKKNGSLRMCA
DFSTGLNDAIESHQHPLPTADDIFATLNGGKHFSQIDLAEAYFQIELDEDSKNLMCINTH
RGLFQFNRLPFGVKPATAIFQQVMDSMISGIEGAAAYLDDIIISGGTHIRSPPFHPQSNG
QAERFVDTMKRALRKLQGEGNADTAIQVFLQNYRSTPCEASPHYLSPAENFIGRKIRTTL
DLLLPSSESPTARNDSMEAQFNRHHGARERMFQEHDKVYVKDFRNPQNATWISGVVQKRI
GRTLYKVLVNGSVWKRHTNQPRRRDIAPFAGSTNIWYLDVVTPPRADNSNQLPSTTQPTP
ASPTSPRLIAPTQPTIRTSTRHRNPVKKLDIDPRTKSYK
Download sequence
Identical sequences CJA02082 281687.CJA02082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]