SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA02172 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA02172
Domain Number 1 Region: 491-834
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.11e-110
Family Reverse transcriptase 0.0000619
Further Details:      
 
Domain Number 2 Region: 917-998
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.56e-16
Family Retroviral integrase, catalytic domain 0.012
Further Details:      
 
Domain Number 3 Region: 385-425
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000897
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA02172
Sequence length 998
Comment (Caenorhabditis japonica)
Sequence
MAQLVSRMDSCLPRFTGHSEVKAAHLLELKNAAVVDFNTIAAKMKEASDRALAEITAFGG
QIDRRATSVTNLARVVDQIRHRIEVLEEQQASLMAQLASSQSGITPSNHPISGVGTVSYV
DGAGTSGDNKVQVAKNPTHKDKVSDNTTQSVHQEIDQGNDQEREDEQSPQLREGQVHRVN
VLGFKSAVSIGTYSGAFSESLASFVRQFKDQMRAADAEASDAAQVNAFLTFLVGNARDRA
EVFLNSNPTSNVDQLVTDLKATFENELTGKLKEAQFSRCRQERGESIETYYNRVRILAAQ
AFRAENNAVIEKRAREAFLDGLDDSIRYNVKDKDPKTCKEAFDEAIRQDILREDRRASQQ
YAPTVALLEEMRSLKQEWINTQSKPKDNFRSREDNRNKPVRRCYHCDKVGHFIKDCRRRL
AGHPKAQQTNAEAVRNHQIHRRPAQVNAAATEDLQAQLEVYKQQVAELQRLNGALLAESG
AHGVRSLAWPKNDRQEVKDNFPLPRIDSILEKVGGSKFFSSLDMANGYLQLRLDPESSYK
CGFTTEDKVYAYTHLPFGLRSAASYFQRAMRTVLAGMEKDVMMYIDDVLVFSKTFESHMQ
TLRKVLTRFREYNLKASPAKCEFVKKSIVFLGHEIHELNYSPNQANLDAIQQMPVPRDVK
AVQRFIGMAGFFRKFIKNFSEIAEPLTKLTRKEQSFEWATEQQQAFETLKEKLTSKPVLG
YPDYTKEFHIYTDASAVAQGAMLAQVSDDQGAIQVIAYASRTLSDVETRRPAIQIELGAI
VFALRHFKPYIWMSKITLHTDHRPLVHILAKRKVNERIARWLIEIQQYDITIVHIDGKKN
TVADCISRAKDEIAPLPTEELEDIIEFPVCMAIDRLKDRVPKQFTPASTKKPVDLATEQS
KDKDIGIIKRFLTTTTTPIDDNASSFTAAAFQQFCNLLDIGHHRAIPHHSKGNGATERTF
RTFHAVMSKYVNKEHTDWDTILPFTTFSYNNTVHSTTG
Download sequence
Identical sequences CJA02172 281687.CJA02172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]