SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA02546 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA02546
Domain Number 1 Region: 150-174
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000488
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA02546
Sequence length 256
Comment (Caenorhabditis japonica)
Sequence
MEDNESEVMKVEMVLDVMDGTVQSDVLIIRKELWERFEEIGRDKWPRAVLRLMREQKLET
VEELRELCERGSLEDRSSTREGEENHQEELIRLKAENERLGARVRECEAEKLRAEKLMRR
AQRAVEEERKTAEELSGSLQKVSRELERLRRYGRTNQCFRCGGVGHVVRQCTSRPVQKVD
TAKKARKAKMVESVKIVGQRRRIEIDSGSVVSVTSTGGWGRSKRRSSKWEKEMEVLAKPN
FRGPPQSGVQVRAKAK
Download sequence
Identical sequences CJA02546 281687.CJA02546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]