SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA02757 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA02757
Domain Number 1 Region: 663-761
Classification Level Classification E-value
Superfamily Acid proteases 0.00000045
Family Retroviral protease (retropepsin) 0.041
Further Details:      
 
Domain Number 2 Region: 598-634
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000733
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA02757
Sequence length 894
Comment (Caenorhabditis japonica)
Sequence
MEKMQAKESKTEAEEEPMLEEMGGNVPIVDEELLLGLDGEVVLEEDGWSGRSEKTAPSFV
EVLDKIKKEEKKNSARKTRSEEDVLRGDSSWAAQMEMEVSIKDRRKLLKGWQKFIVASEK
LETEMKEKIGLFTTCSSRAKNSIIAPVKKFGEELRGRWEEMGGETWIKSVMAVMSVMQIE
NPIELEKALVEGGKQEKEENEKLKKDIFNFQVLHKAEKRELELKVEKLEEELDRARRRLE
VAEKAAKSEKKRALEMKSNLERAASESDESDDYDEIRKQIQARSTRAEGPGRRWSRSSAQ
PQAKDCKRTPETYSAGTSKWDVESVEVKRKVSSWLEENSERRGSEESVKLRKSQKREEER
SEAESWRSRESEKMIKSTMISMSKMMRSSAMPEPKVFDGMGNFGEFRRTFMMKYKEVVEE
DADLVAIVEEKYLHGAAKMLFRSIENRFGRPIKEVFEEFEQRLRRRQGDSRTHALAEFDG
LRRGVNQRMWEYIPEIEKWSQKAYPNLDKESLSQMRVTKLMMAVKADHNLQNLLVMKRRE
TAPEEQYETLKDIVLQQENERRRDYSQRKDFNGIQRVKKEYLWRGNEERKNQEAGRTVQK
RNEERCERREDNRNSAKCFNCGGRGHVARQCTSRPVNRVDKDEKKSENGIVGAEMVEQCE
LLGQRRKVTIDSGAVVSVISSGAWERLKKGCRDWKDKCEMLEKPQFTLINASKLSMPVTQ
QVRLEIEIRGRKAPVVFQIVHNEMDLFLLGTNAFKTIGVELKWQAERAVARTAQKLRVPP
QTCAQISVKLDADMGAQVLLESSEDWMANSLCTKNEKEILMAVVANWNDQPLLIKKNQVL
GVVSSDWEIYEKKNDFSVNMMDLDRKRATEKSDMKEKVFQMLEDNGNIPEGKIQ
Download sequence
Identical sequences CJA02757 281687.CJA02757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]