SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA02906 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA02906
Domain Number 1 Region: 427-857
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.96e-116
Family Reverse transcriptase 0.00011
Further Details:      
 
Domain Number 2 Region: 323-397
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000334
Family Retroviral protease (retropepsin) 0.016
Further Details:      
 
Domain Number 3 Region: 264-304
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000204
Family Retrovirus zinc finger-like domains 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA02906
Sequence length 869
Comment (Caenorhabditis japonica)
Sequence
MTKAHNQEALTEALAALMTPLASSNELHRQLMEENRALRDAASAAEPPRATAGGTRVPHN
IGEPDSFKRWFSRHEPIFEEDGSELSEREKTRLLLGSLEETTFHRFVDSQRDVEDVYGVT
FKETVAALMKIFGAQRSIMVQRQACFHISRSLGNWEDPLEYTNHIGQLVADAKLATMTAD
EWSVFLFFRGLDAPGDAAAKNYLMQFTEMAERKGDTITLSQIHDEWMRFLQIKQQTKIVA
TSKQNPQTPVEVRKLGASKPKRRESPKVRPEGGSKNRGPLFCEYCKKTGHHVSKCFLKKK
EGNKKTQAIKVDVVNAELSAKRSVRVNVNGKPLQFDLDTGSMITLINSKSWKFIGRPPLE
RVEHRISCANGSEMREYVYVREKDTNLIGMSWLSQSPLMRKAMDSMVNQIELPSAGKAAS
RLETKLTEEFPTVFSERLGRCCKEKAQFRTSDNAPPIFKRARPVPYGSLEAVEKELERLQ
DIGVIEPVTHSKWASPIVVIKKKDTGKTRVCGDFKCSGLNKALRDEYHPLPTCEDIFGKL
RGSIFSQIDLKDAYLQVEMDEESQHLAVINTHKGLFKYKRMAFGLKTAPAIFQRIVDKMI
SGLSGVAAYLNDVIVSADSMEEHETNLRNLFKRIEEYGFRVSPDKCTFARSEISFLGFIV
DTKGRRPDPKKTSAIRTMKAPNDQKQLSSFLGAICFYSRFVSNICTLRGPLDRLMKKDVT
WKWTNVEQEAFEKLKTAVADNTMLSHFRDDWPIIVAADASAYGIGGVLLHTNPDGIEVPV
AHVARSLTDTEQRYSQIEKEALALVYTVKKCHKFIFGRRFHLQTDHRPLLAIFGSSKDLP
VHAQNRLVRWAMTLMAYVAPAEDCMALIC
Download sequence
Identical sequences CJA02906 281687.CJA02906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]