SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA03777 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA03777
Domain Number - Region: 86-188
Classification Level Classification E-value
Superfamily Acid proteases 0.000169
Family Retroviral protease (retropepsin) 0.03
Further Details:      
 
Domain Number - Region: 234-255
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000174
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA03777
Sequence length 519
Comment (Caenorhabditis japonica)
Sequence
MWEYLIEVEKWSRMAFSVVGDETLSQMRTTKLMKAVREDDTLHKMLIMKRFEVPLAQHYE
QLKDINVEAEEAEAVKSVGPKTVELVEILRQKRRIVIDSGSVVSIMSTGAWHRLKKGYPS
WVKEVEILVKPRFTLLDASKTYMPVKEQIKIEIVVRGKKALVVFQLVENKADIFLLGTNA
FESIGVELKWKAEKALDLKAERYQPPEQTKSVQWKSSNRVEKATRALKRLRRYGSANQCF
RCGGVGHVVRQCTSRPVQRVDTTKKARKAMMVKPVEILGQGKRFEADGGSVVSVMSTGGW
ERLKTRCAELTKEAEVLAKPCLIEPSQSDSRIVARAEACLGQAICREAEKKCVPTNQGSK
SEERRMTKVVTNRMFIKRNHVIGVGSRRGAKCTPMAARAMKAKRGRREVQRRTVNCARRN
VKSNFNVEDMELSFRRTLEDRHDGVYTVKPDWNRLPNSLSASETIDSMESLADCRGMAVP
EHESGTSRRRSRSPSGKESRRDVDTLLRARAGRMPRHHY
Download sequence
Identical sequences A0A2H2HZS6
CJA03777 281687.CJA03777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]