SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA03993 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA03993
Domain Number 1 Region: 151-174
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000153
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 
Domain Number 2 Region: 199-300
Classification Level Classification E-value
Superfamily Acid proteases 0.0000251
Family Retroviral protease (retropepsin) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA03993
Sequence length 353
Comment (Caenorhabditis japonica)
Sequence
MNKMMRVAALPEPKVLDGSGSFREFKRTFLMKYSEVVEDDEDLMAILEDKFLVGTAKSLF
RSLENRRKKPIKVLFEDFEEKLKRRQGDSQTHALAVFEELCRGAGQKMWGVLGGSGEVVT
TKSCWDGSERWKTGDKEERQSDGEASQKSVDQRESMKCYNCEGVGHIAKQCTSKIVANVV
RKNQLEGTRSSKVKMWETCEILRQKRKVTIDSGAVVSVISSGAWEKLKRGCIDWKEKGEV
LAKPHFKLVNASKLAMPVQEKVKLTIKIKDRKAVVLFQIVRNNADIFLLGVNAFKAVGIE
LRLKPKEAVMQRASGYGDFSGVHRITWRMERENVQTNADASAAKGRRVRMKRR
Download sequence
Identical sequences CJA03993 281687.CJA03993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]