SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA04136 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA04136
Domain Number 1 Region: 422-575
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.16e-35
Family Retroviral integrase, catalytic domain 0.015
Further Details:      
 
Domain Number 2 Region: 277-368
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000184
Family Retroviral protease (retropepsin) 0.011
Further Details:      
 
Weak hits

Sequence:  281687.CJA04136
Domain Number - Region: 218-254
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0016
Family Retrovirus zinc finger-like domains 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA04136
Sequence length 625
Comment (Caenorhabditis japonica)
Sequence
MADLARRIQKYSYTIGEPDSFMRWLTRHEPIFEEDGSELSEREKTRLLLGSLEETTFHRF
VDSQRDVEDIYDVTFKETVAALTKIFGAQRSLMVQRQACFHISRSSGNWEDPLEYTNHIG
QVVAGAKLATMTAEEWSVFLFFRGLDAPGDAAAKIYLMQFTEMAERKGEAITLSQIHDEW
MRFVQIKQQTKIVATSKQNPQAPVEVWKLEARKTKGRENPNFTPKWGSKDRRPPFCDYCK
RAGHHISKCFLKRKDEGTETQSIIVDVGNAELSAKRSVRVNVNGKPLQFDLDTGSMITII
NSESWNMIGRPPLERVEHHISCANGSEMRVLGRARVSFALKGSQYKGYVYVREKNTNLIG
MSWLSQSPLMRKAMDVMVNQIEIPSAGMARLKDNPTVRSGNCQQNTKRTRITPSKPCPDT
KKPWAHIYVDFAGPINGYWFLVVEDAKTKYAEVKLTRKASAAATVDLIEEIFATHGYPDW
IVSDNGTQLSSQLFKKMCESHGITHKTTATYCPRSNGAAERFADILKRGIAKIKGSASIN
QRVLNNFLINYRNTPHAALNGATPAECHFSRKIRTTRSSPMLAERASEYTEWTHYQNKMK
GPSLYRLRPFTTPTRGSRATNRTLL
Download sequence
Identical sequences 281687.CJA04136 CJA04136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]