SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA04274 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA04274
Domain Number - Region: 157-184
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000481
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA04274
Sequence length 440
Comment (Caenorhabditis japonica)
Sequence
MAIDGVAPRAKMNQQRSRRFRASKEAAEKAASIEEQRRRLMAEGIAVPPKKEVEEHFDSN
CITPGTPFMARLADALRYYIHDRVTNDASWANIEIILSDANVPGEGEHKIMDYIRKQRGN
PAHDPNTVHCLCGADADLIMLGIATHEANFNIIREEFVPNQPRACDLCGQYGHELKECRG
AENDQDLGDDYCKPEQREKNFIFLRIPVLREYLEKELSMPNLPFKFDLERALDDWVFLCF
FVGNDFLPHLPSLEIREGAIDRLIKATGLFLKLYKDMVYQMRGYLTKDGIPELERVEMIM
KGLGKVEDEIFKRRQQDEERFRENQKAKKARQQQFGFGRGGRGRGRGRGAPAYIPNQGIL
APMSAPRHHSGQSTRQMASDARQTAMQFNDDANAQAAANLKMLLNVKGEESPAEKDSRKA
GFMKLKNDRKPVLRKITFGN
Download sequence
Identical sequences 281687.CJA04274 CJA04274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]