SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA04336 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA04336
Domain Number 1 Region: 175-208
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000117
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 
Weak hits

Sequence:  281687.CJA04336
Domain Number - Region: 229-270
Classification Level Classification E-value
Superfamily Acid proteases 0.0344
Family Retroviral protease (retropepsin) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA04336
Sequence length 310
Comment (Caenorhabditis japonica)
Sequence
MWEVEKDNLLEELESEREKAQKLSESQERLKRKVVKLEKALVVEKQWFLKNSSFLLFSLL
WRSLSRQLLSPFDSAENLLLNDVIKSKITMTTKLMMAVNDNENLHNLIIMKRLDYSIENQ
YENLKDVVFQQEQEKRQSLKKGHSLLMNEGKMKKDTSWRRSDCQPKQFKEEQKDEMGSKR
VENQSQPNLRCFRCGGIGHTSRQCTSKSAYVVEKKKSEKSEGVGAEVVETVEILGQNRTI
FIDSGAVVPVMSSAVWERLKKGCPDWDKRVEVLAKPVFTILNSSKAEMPVENQLKLEVRV
RGRKALVSRQ
Download sequence
Identical sequences CJA04336 281687.CJA04336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]