SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA04539 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA04539
Domain Number 1 Region: 148-489
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.33e-102
Family Reverse transcriptase 0.00052
Further Details:      
 
Domain Number 2 Region: 48-140
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000985
Family Retroviral protease (retropepsin) 0.011
Further Details:      
 
Domain Number 3 Region: 2-32
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000504
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA04539
Sequence length 531
Comment (Caenorhabditis japonica)
Sequence
MHWARDCKLSSNTVCRNCNKNGHLAKVCKSKRSTNNAIFIAQSSVQNRNRIYYNVKIEGK
QIKMQLDTGAEVTLMNAKDWMRLNKPKLSHSTINLRTANNEPIKVKGQFKCNFNLNGHHG
SGLCHVTDTASLLGLDWIAQDTTLYQHLIQASHPLPTAEDIFSTLNGGKYFTQIDLSEAY
LQIEVDEDSKKMLTINTHLGLFYPNRLPYGVKSAPAIFQQIVDTMISGLEGVAAYMDDLI
ICGSTVEEHNRRLHSLFERIKEYGLRVKSSKCSFLQSEVKFLGFIVNRNGRRPDPAKITA
IEKMPAPTDVSQLRSFLGLVQFYGSFVKDLHNFRGPLDELTKKDVDFVWTKSCESSFGRI
KDVLKSDLLLTHFDPKLPIIVAADASNYGIGAVITHRMADGSEKAIFHASKSLTTAQRGY
SQIEKEGLGLIFAVEKFHRYLHGRKFTLRTDHKPLLAIFGSKKGIPVYSSNRLQRWALIL
LNYDFDIEYINTASFGQADALSRLIATNLANVESEDRVIASVEADLDAETS
Download sequence
Identical sequences CJA04539 281687.CJA04539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]