SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA04615 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA04615
Domain Number 1 Region: 87-111
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000222
Family CCCH zinc finger 0.0047
Further Details:      
 
Domain Number 2 Region: 257-281
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000715
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number 3 Region: 209-240
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000123
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 
Weak hits

Sequence:  281687.CJA04615
Domain Number - Region: 167-191
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000124
Family CCCH zinc finger 0.0038
Further Details:      
 
Domain Number - Region: 142-167
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00249
Family CCCH zinc finger 0.007
Further Details:      
 
Domain Number - Region: 61-83
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00798
Family CCCH zinc finger 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA04615
Sequence length 315
Comment (Caenorhabditis japonica)
Sequence
MLVVAQHVQDIQLNAMQRAFAPQTMSELISNVTAPMTDVEEALFNQRGLKEAPFRDLDRS
GRAVCRKNKLGICPFGHNCPLRHIIGEKAVVCKHWLRGLCKKGDQCEFLHEYDLTKMPEC
FFFSKYSACSNRECPFRHIDPETKLKDCPWYDRGFCRHGPYCKHRHRRRAVCPNYLAGFC
PQGPDCQYAHPSFNIPSFENTAPVHTHYQQRAPYSQAITCHNCHERGHKATTCPHLPGQN
RSNHDRSQAVDLSLIPDKKNLSDVTCYKCGEKGHYANRCHKGALAFLSNTAHLAHEQREK
DEKELGRVNNMFRPA
Download sequence
Identical sequences A0A2H2I163
CJA04615 281687.CJA04615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]