SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA04679 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA04679
Domain Number 1 Region: 559-744
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 3.53e-28
Family Lambda integrase-like, catalytic core 0.01
Further Details:      
 
Domain Number 2 Region: 216-388
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.78e-27
Family Reverse transcriptase 0.0037
Further Details:      
 
Domain Number 3 Region: 184-221
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000023
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA04679
Sequence length 768
Comment (Caenorhabditis japonica)
Sequence
MEDVEKTGDQSSLVLKLAEMQSNMMEKMQNVMKSLENQEKPREEEKAPKVTQKGIQKNID
FNTKLRNILLGAVGTTALEEKVNQALDLLAKRNSELVMLDTAPEMLKAKEKFEALRAMSA
TTGAQGQDTDWTPLLVLSQMQSMHQSSAETNTKRRRTEQEPSNRWFRSEGTFRGNGGARF
SGSQHTFKPRQAEKKSSKCFNCHRYGHFATECNQRRSGYHHIKIHKDSQDLLAFSLSDPP
AKPYYVFNALPFGLCTAPWIFTKLFKPLIRKWRSEGIKIFLYLDDGLILAETKEEAERVV
ERVRKDLKNAGVCVAEDKSFWVPETRFRWLGYECDLITREVRGTEKRMEKLCVALNMLRG
SVAPTILDRMKFLGGLASLSIVSGDSGVARSRNLMQAVAESQKAGENENKKKNKTKEKLN
PERVESTSSNTYQERHPLDYLGGQKRDFLLKMMKTSDTEDKKLIDSLALVPYNSKAMSTT
KAYKLANEKRVEWALTKKLTSPEESLLLYMAEKAKTVGSSALATISAAYQAANETCSSIC
QAFVTDLIKATRRKETEKKKEVVEVEIQDIEKIVKLALDSNEPSLDRDALIAVLSFKAML
RASEAANLEWSDVRMEQNMIEVKIKRAKNDQMALGRLSFFEYEAGSDEDILMCRWRLRKR
GNCQHVFSTLHGAEPLSAASISSLASKMLSKIGKFGATHHCFRRSGANYLQSQGFSFEEI
QKRGRWRSQAGLQRYLKDSPRAQGCLPKPMLEPYEQLPTSSTTQALPS
Download sequence
Identical sequences CJA04679 281687.CJA04679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]