SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA05016 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA05016
Domain Number 1 Region: 495-538
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000384
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 
Domain Number 2 Region: 577-683
Classification Level Classification E-value
Superfamily Acid proteases 0.00000024
Family Retroviral protease (retropepsin) 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA05016
Sequence length 875
Comment (Caenorhabditis japonica)
Sequence
MSRLEFEGQMRAESMEAEEAVERESDTAPGDEDHWKLQVEELEREIEEWKKDDVEKERTI
QALREQIQSGADGKFQQVCEDFLIKSPEDLHKSLGNLIKLELKLSENKFELLQKLEKEAK
LRRMLEEAKQQSETLRLKLKMAEDARIHAEAQMDELKRAAGQNSLSRRGEVINREITHNY
TSQIGEKLRISRPAAIQPRSGESFFDIENGVEKARAYSKITEEILDSEEDGEVFGNGCGD
TQWTSTPKTERKKSSETLLEKILLAQAIPEPKPFSAEKATSLKMFKHSFAMKFRTLPVFD
QLILLESRFLEGKALKIFKGIPTKEKTSMDDVFDALAERLRVSTQDEARTAKTRWERLKI
REGQTIEDYCLELDEVAKKAFGRTSPEEFSSTKTAKLLTALSDDYQLRGMIEWQLRGIPE
EDQYDECRKYAIVLEKGRIEMQQSKKFQHIPAKQTATHHQADHLKNVRMNPAKKQIFTEK
VEEIPKESSLLDKRSSFPQCAECNQWGFHMPTCSKSPAVTCYGCGEKGHIAPKCPKRTDR
LKEQTHGNAVNAVDKGKAKKSENSDEAETTILDVTQIQTGKIGSSEVKVLVDSGSTISLI
SKNIWQRLIRENGKEWEKSIPKKAPEIRTVVAANDTIIKLLFEAKIETIMATRTRKIVYH
IADVPRETIILGTNAFRDMDITMSIGGISRDAKLTKAVRIKANENKMVEVQVEGIVLGEK
RSCLITPTSNFLSPAICHVDKDGKTSVPLRIRTTSNSGVSNLGASDPYHFGFVPLLTRAF
LIWAPRNRTTSNSGGFGFGRSADSYHFGFGRFGFGAAPNTRPLDLHSSPNMTSLFDLPSL
LYCHVTTTTKPYKFSIPNHKTYFLVLTGPNTLTKS
Download sequence
Identical sequences 281687.CJA05016 CJA05016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]