SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA05531 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA05531
Domain Number 1 Region: 1167-1330,1359-1437
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.84e-38
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 137-297,397-464
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.62e-35
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 3 Region: 1512-1765
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.77e-34
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 664-809,874-942
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-32
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA05531
Sequence length 1901
Comment (Caenorhabditis japonica)
Sequence
MKTQFKSAFTVLSASLQISLYQFLAGEHRQSQSTGGNLSQYGNMKISSREAIFTLFFQAL
GSIEGSKETLQLSEHGRLASSSEASPSRWEGRQIEWGNEDQIEEDSELPYPGFAEPTLRC
LYQARPPRKWALQMVMSPWFDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDN
CIFVYFAIEMVIKIMALGFSGPAAYMSDTWNRLDFFIVMAGIAEFILHEYLGGNINLTAI
RTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRN
RCVINLPNSISENQTALFNNVKLTRFYIPEDTSLEYICSQPDANGLHTCSNLPPYTVNGI
KCNLTINEYDKVTNESCINWNIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGW
TDIMYYVQDAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQFAETKRRETERMLQERKRL
QRDSISCTGSEVGGASSKEEGDTVYAAIVRFIGHTFRRTKRAAKRKYNAYMEERAERKTS
ERNQRRKSKLDDMATLSRIEEKAEDEEDETPTHAQTEQERLEPNGDGARIKRVKIEEEPR
VKVGNGNSNGPHHKHEESEADEDDEEEDEKDGDWDDEKTEKRRKPSKIRWFRDKIRKFVV
CDHFTRGILVAILVNTLSMGVEYHQQPEILTIILEYSNLFFTGLFALEMLLKIIANGFFG
YLADGFNLFDGGIVALSVLELFQEGKGGLSVLRTFRLLRILKLVRFMPALRYQLVVMLRT
MDNVTVFFGLLVLFIFIFSILGMNLFGCKFCKVEEKFLGGLAKKCERKNFDTLLWALITV
TLGMVLFGCKFCNHPDTGLQCTIPQVNSKLCACDRMNFDTFLFAAVTVFQILTQEDWNMV
LFNGMAQTNPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEEKRQLEEEARIQAVE
EEDERKRELELLIAKTASPVFSNGVLPAECTCQTPTTQEETPSPRLLTVNYHSPPERQHS
SNIDAIIDRRLVSTNSAPFDRFPTSDGKDDIRLNRHASLVLPVANGVPYRRQRVHSWSGL
CHHFNPNCPVHGRRALIETYAREKFLEASQELKQALAEEERRNEAKQNTFVRKLLKKTCL
HNRTEYSMFLMGPKNPVRIKCLQTTQKKWFDYTILFFIGINCITLAMERPSIPPDSFERK
FLQISGYVFTVIFTGEMMMKVVANGCFIGHSAYFKDGWNILDGILVIISLINVSFELLAT
GDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFG
ILGVQLFKGMMYHCIGPEISNVTTRAECMEDHRNKWVNHRYNFDNLGQALMSLFVLSSKD
GWVSIMYQGIDAVGVDMQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKEA
LEREMREKEKEKRLKRKLKRQKYEESMAGKQKKNRIMWVGSTIKSIFSVERNYPYYRDYG
HTRLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEA
AMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARV
LKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGL
GEHAHFKNFGMAFLTLFRIATGDNWNGIMKDALRDDCETADHCETNCCVDPILAPCFFVI
FVLISQFVLVNVVVAVLMKHLEESNKRDAEGPAEPTGKCENVENEITKSEDDCIAEEVEP
LAIEDNNDEEVEATTTEIPDGHGGIKRLSMQVLEQELIEVERNLEEKIRRASECHGELTQ
LNEHDSDDPDFRPRSRSHRPRARANSVLSNKSRGSHKSSAT
Download sequence
Identical sequences 281687.CJA05531 CJA05531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]