SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA05578 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA05578
Domain Number 1 Region: 454-477
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000227
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Weak hits

Sequence:  281687.CJA05578
Domain Number - Region: 627-702
Classification Level Classification E-value
Superfamily dUTPase-like 0.000185
Family dUTPase-like 0.0072
Further Details:      
 
Domain Number - Region: 516-621
Classification Level Classification E-value
Superfamily Acid proteases 0.000469
Family Retroviral protease (retropepsin) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA05578
Sequence length 1090
Comment (Caenorhabditis japonica)
Sequence
IIVSKLCIFRFFLLLLFSLFFYFFSEKHIELVEVRQQLNAEKEKSRLLKLKLEMVQEQKG
KLVKDSEWMEANLKANSYTRIGEKEHYRNYKNESVQIMAPTLTSSGSTETQRVRVLPGEP
NKKWDEGIERPRFSERAEETLEAAEIEDESFLENTRRSPEYIRSRKVTVPKPKSSESLVE
VFGQWMMNQHLPEPPKFSAQESTVSLLSFKKSFLMKYGQLEDEDQRNLLETKFLSGKARQ
VFRGLPDSEKRSVDIILNALANRLRISPEDESRRAKKAFEDIRYYEGQSIEDFCLQIDEI
AVTAYRRCSVEEFSSLKMTKLQSALVHNPSLACMIDNKLGEIPEKDHYDTARRMVVRWEM
GFQQYRGSSSENTKSKLRTTRVPSALLPLNTWNPGALPPVPKARSNAPEQKWRTGNPNQS
ESLKTCDLRQCADCHSVGFHHPHCPKAPGAQKVLKEVTCFHCNEKGHIAPNCPNQPNSSF
QASELLNEPKIDSIEKEKCLVVTAEADKPLAKIEHGRIGSADVNILWDSGASISLMARKT
WERIAATNGSEWERTVKLEQPIQETVYAANNQPIDLLFQVTLKTAMQARTREIPFYVADV
NRDTIILGLEQFEKMGIQMVMENRPREIRLMQEIWLAPGSQKIVPIQIEGIIDKNKTFCL
VNPLSEVITPAICQVDKLGKSIITLANFGKETIRLKNGETIAFGELKGSEVFEESPKEWE
TLNECISSTRQIDKIMLNNVYTGSVKNRQEKRTVMTLEENKQAKPSVHESKKSAHSNGDL
SMFLMSGDSNGPLEMAGEDAVGIDYSGSNENKFIQKQKLIKFHEFEKDHADKKVEKHNDA
KIEIFGESGLCCNEVSLRNDHVNPNNFSNRYTCRCAPQCCTFVMKRRNGYDATDAKTESP
TQFCRMWHLVETNPEWLLDIPSLLLVSQMPFLRGDPTPTKEMLLHMSHCPTLYLCCKDVL
GWEQAYHQAYQEIMDAKVGTELLNPCKVVVLVDPVVPEGAVPILTKDVVVLAPQQEKQII
TTMVNEKFQLLIFVIPVILDAAKVELWTRCLNWLQDSVEVILVAADYCLETVYFSFFSSS
SFFSFFYFFS
Download sequence
Identical sequences 281687.CJA05578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]