SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA05850 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA05850
Domain Number 1 Region: 760-789
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000349
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 
Weak hits

Sequence:  281687.CJA05850
Domain Number - Region: 815-917
Classification Level Classification E-value
Superfamily Acid proteases 0.000394
Family Retroviral protease (retropepsin) 0.028
Further Details:      
 
Domain Number - Region: 593-648
Classification Level Classification E-value
Superfamily Kinase-associated protein B-like 0.0811
Family Kinase-associated protein B-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA05850
Sequence length 972
Comment (Caenorhabditis japonica)
Sequence
MIKMGKSIKNCLKNRAAVAKVGGANFLVFFHVFWSKSTTFLAFFMIKMEKSIKNSLQNRA
AVAKVGGANFLVFFPRFLHHHDDHEHEHEHQHDHDHHQENVKKHRKIERLSTLKTWVYSL
SAVFGISVAPCALLFFIPAQHANGPFLKILLAFGAGGLLGDALLHIIPHALSPHDHGHED
AHGHSHGHSHSDSSGHDHSQQLRVGLYVIAGILVFMLVEQLVRIIKCHWLKTAETITKLL
NKSFADGQRMDEFMETMDGVLEELVEENRRTDAEAAVSGRATRGADGRKAWRMTDESTIG
TIEEELQSEDEVMSLKQRRRKIRGFAKFVATATEVEQETRRKIALMTKCSERQKELIIEP
FMKFSRELLERFEEMGGDQWTRSVLRVMREFGLETVESLREACEKAVSGSEVGTSREKLK
KEVEKLSNEKTLLQEAWMEEKNMLKEQMEQLEREKNFAEECLGQLEMTRSVEKKTAEKLE
RSLQQCSDELEKLRQANFRRSLKEDLKPRFSQKVDCGNEHLRVKVEDWEMESRSSRSSGM
REMVQCMSRMMKSSALPEPKTFDGSGEFGEFKRAFLLKYQHVTDGDDELVAILEEKFLKG
AAKTLFQSLPKRYERSLKSLFEEFEKKLRKRQGDRKAEALNEFEELKKNPGQKMWEYLIE
VEKWSRMAFPEVGDETLSQMRTTKLMKAVREDDTLHKMLIMKRFEVPLAQQYEQLKDIVL
QQENEKLREHGQKNGNRNKFKERRENDWDKEKRYSDAEEDNRKKEEGHSKESSTCFRCGS
MGHVSRQCTSQLVQNVEAEEAEAVKSVGPKTVELVEILRQKRRIVIDSGSVVSIMSTGAW
NRLKKGYPSWVKEVEILVKPRFTLLDASKTYMPVKEQIKIEIVVRGKKALVVFQLVENKA
DIFLLGTNAFESIGVELKWKAKRALELEAERYQAPEQTKSVQWKSSNRVEKATRELKRLR
RYGSANQCFRCG
Download sequence
Identical sequences 281687.CJA05850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]