SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA06265 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA06265
Domain Number 1 Region: 275-319
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000221
Family Retrovirus zinc finger-like domains 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA06265
Sequence length 484
Comment (Caenorhabditis japonica)
Sequence
MSKENEEFMLRMMRMFEKQIEQHQAAMTALVQAMTSKSNDESRADMTPTTSGVSQTQLMN
DIGSRVAMFQFDLETEKTFSKWYARHEAAFTVEGKDLEDKSKVSLLMSKMSDEVYEQYSK
RICPRKHTEVEFDETVKTLEQMFDIKKSLFSHRFACINIARDDETPVEYTTKVNSMCESA
MLQDIDAEGWKVFFWLKGLDASRDKSARTYFIRYVEQKWEKKEPVNVNDLCEEWKKLLRQ
NSVVQEMEQVDKAVRALHTKKDFNRNHKKLWNREQSNGKVDECWNCGKVGHRKPDCVQRL
TKCLKCQKTGHLSKYCKSKGSKKAXXXXXXXXXXXXXXXXXXQSKVAATSVTRSSASQKR
ESCSITNKSFGPTNAFEEQIKWTSDGKQWEYPIDNEFRMGEESNISFIDHVFLERHLPSL
GIPKTGPIAHFMHLVCVGLSKNPYMTAAKKREHLTWFADYFNTEKQKLVHKLHEQEQIAA
QNAL
Download sequence
Identical sequences 281687.CJA06265 CJA06265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]