SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA06760 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA06760
Domain Number 1 Region: 667-768
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000901
Family Retroviral protease (retropepsin) 0.016
Further Details:      
 
Domain Number 2 Region: 501-539
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000012
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA06760
Sequence length 894
Comment (Caenorhabditis japonica)
Sequence
MDHPPQLSCEAARAANPTSFRDAVIKDLHLAHNRITDVYESVQCRIEELRVQKTSGLTPT
AGASVVHALHERGQGATPADSPHSPRPEHALPPPTHTISPQGDSPCNQIFSAKEGKPSET
DDVVTDLPIQQEKGNLRDREDMETEKENSSSAATTVVSETDETSRRQDTTGDNINTQTNP
IVGNETRAQQDCRNSRSNSATRRVTRSMTANAPPRVNVCAMKTNSSVPMFSGTTKENFHT
FMRHFTDHLNIMQNPSNREVRNLLLTVLTDFARDKAEEVLEANPEATYEDICKSLRSQYE
NQYTNQARLDAIKGCFQYDQEPVQDYYQRIRAAMRDAQTGTNRQNVLTVALEAFIDGLQP
EIRFQVEMRQSSDFEEVFKDAIFAEKALNRKVKSVRTNETLAATNRQQLPDVYAQAVQQH
QAQFRYVHNNPAGEFYDDANSDTGVPGIAAFAPRREVWHGFPRGNIHYPESVDAFQHNHM
FRRNFDHNDMSLNSLRQTKNETSSLGLNRQQLAFLNAQCWYCGRIGHNRQDCRTRTRDRF
QGTYRTTILDPPHASHRSNTPRNHSHQQPLDSTENHHQPTIRVIGTNERARTEEQNRYRE
QYEEQLRINKVQENRIKDMTWRLHAYQMGQDSSGYSTPNVNIITPLEKEAKSVAARPQVL
SYVTAQVPITANGHPCYALIDTGANITITSESFHDLFCSVPMLPPTASSAIGLGGNSVCM
VGSAFIRFGISKYVVESWIHYTKGTGTPSGPKDYTFIIGNDVLSQLPIFQFDYAKGKFHI
GNSTLPLGLPTYLEARQGSDKLQLNEDSAISEKDQHPLSHKSCSQEKKKKKKKKKTTNFP
RGICSILLATMVSTMIAFGKGVSSWFQITHPRMPVDWLKIKNRDVFTCPGCFLD
Download sequence
Identical sequences CJA06760 281687.CJA06760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]